Proteintech, 29621-1-AP, NDUFA9 Polyclonal antibody

Size: 20ul / 150ul The NDUFA9 (29621-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29621-1-AP targets NDUFA9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, mouse heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: human hepatocirrhosis tissue, rat kidney tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NDUFA9 (NADH: ubiquinone oxidoreductase subunit A9), also named as NDUFS2L, belongs to the complex I NDUFA9 subunit family. NDUFA9 gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I). Instead of being implicated in the catalysis, NDUFA9 is required for proper assembly of the complex I (PMID: 34938809). The predicted molecular weight of NDUFA9 is 42 kDa. With modification, the MW of NDUFA9 will be migrated to 35 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31222 Product name: Recombinant human NDUFA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-227 aa of BC009311 Sequence: WDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIP Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa Calculated Molecular Weight: 377 aa, 43 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC009311 Gene Symbol: NDUFA9 Gene ID (NCBI): 4704 RRID: AB_2918331 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16795 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.