Proteintech, 29652-1-AP, TNF-alpha Polyclonal antibody

Size: 20ul / 150ul The TNF-alpha (29652-1-AP) by Proteintech is a Polyclonal antibody targeting TNF-alpha in WB, ELISA applications with reactivity to rat, mouse samples 29652-1-AP targets TNF-alpha in WB, IF, ELISA applications and shows reactivity with rat, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, ins resistance, and cancer. Specification Tested Reactivity: rat, mouse Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31037 Product name: Recombinant rat Tnf protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC107671 Sequence: MSTESMIRDVELAEEALPKKMGGLQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPNKEEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL Predict reactive species Full Name: tumor necrosis factor (TNF superfamily, member 2) Observed Molecular Weight: 26 kDa GenBank Accession Number: BC107671 Gene Symbol: TNF-alpha Gene ID (NCBI): 24835 RRID: AB_3086148 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16599 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.