Iright
BRAND / VENDOR: Proteintech

Proteintech, 29653-1-AP, PPT1 Polyclonal antibody

CATALOG NUMBER: 29653-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPT1 (29653-1-AP) by Proteintech is a Polyclonal antibody targeting PPT1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 29653-1-AP targets PPT1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, HeLa cells, SH-SY5Y cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The defective gene behind the INCL(infantile neuronal ceroid lipofuscinoses) disease, CLN1, encodes for palmitoyl protein thioesterase 1 (PPT1). It consists of 306 amino acids, including a signal sequence of 26 amino acids and three N-linked glycosylation sites. This protein exists with a molecular mass of 32 kDa, 34 kDa,36 kDa, and 38 kDa. The enzyme is transported into lysosomes of non-neuronal cells by the mannose 6-phosphate receptor (M6PR) mediated pathway and a significant amount of native PPT1 resides in a complex rather than in a monomeric form(PMID:17565660). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31240 Product name: Recombinant human PPT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-306 aa of BC008426 Sequence: PRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG Predict reactive species Full Name: palmitoyl-protein thioesterase 1 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 32-34 kDa GenBank Accession Number: BC008426 Gene Symbol: PPT1 Gene ID (NCBI): 5538 RRID: AB_2923599 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50897 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924