Iright
BRAND / VENDOR: Proteintech

Proteintech, 29663-1-AP, MADD Polyclonal antibody

CATALOG NUMBER: 29663-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MADD (29663-1-AP) by Proteintech is a Polyclonal antibody targeting MADD in WB, IHC, ELISA applications with reactivity to human samples 29663-1-AP targets MADD in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MADD, MAP kinase-activating death domain protein, belongs to the DENN family, which regulates the Rab family is small GTPases (PMID: 20937701, PMID: 18559336). MADD plays a role in synaptic vesicle formation and in vesicle trafficking at the neuromuscular junction. MADD is also involved in TNFA-mediated activation of the MAPK pathway, including ERK1/2 (PMID: 32761064). KIF1Bβ- and KIF1A-mediated axonal transport of presynaptic regulator Rab3 occurs in a GTP-dependent manner through MADD (PMID: 18849981). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31292 Product name: Recombinant human MADD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1395-1544 aa of BC040484 Sequence: WRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS Predict reactive species Full Name: MAP-kinase activating death domain Calculated Molecular Weight: 1544 aa, 171 kDa Observed Molecular Weight: 200-250 kDa GenBank Accession Number: BC040484 Gene Symbol: MADD Gene ID (NCBI): 8567 RRID: AB_3086151 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924