Iright
BRAND / VENDOR: Proteintech

Proteintech, 29709-1-AP, KLF10 Polyclonal antibody

CATALOG NUMBER: 29709-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KLF10 (29709-1-AP) by Proteintech is a Polyclonal antibody targeting KLF10 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 29709-1-AP targets KLF10 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, MCF-7 cells Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KLF10 (Krueppel-like factor 10), also known as TIEG1, is a transcription factor that plays a role in the regulation of cell growth. KLF10 plays a role in the response to TGF beta (through the TGF beta/Smad signaling pathway) and estrogen. KLF10 has been shown to have a role in skeletal disease (osteopenia/osteoporosis), hypertrophic cardiomyopathy, and breast and prostate cancer. KLF10 can be detected 51-52 kDa, 60-75 kDa (PMID: 21262377, PMID: 30026232). Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31772 Product name: Recombinant human KLF10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC011538 Sequence: MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKA Predict reactive species Full Name: Kruppel-like factor 10 Calculated Molecular Weight: 469 aa, 51 kDa Observed Molecular Weight: 52-75 kDa GenBank Accession Number: BC011538 Gene Symbol: KLF10 Gene ID (NCBI): 7071 RRID: AB_2918341 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13118 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924