Iright
BRAND / VENDOR: Proteintech

Proteintech, 29758-1-AP, DYNC2H1 Polyclonal antibody

CATALOG NUMBER: 29758-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DYNC2H1 (29758-1-AP) by Proteintech is a Polyclonal antibody targeting DYNC2H1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 29758-1-AP targets DYNC2H1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: mouse kidney tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DYNC2H1 (Cytoplasmic dynein 2 heavy chain 1) is involved in ciliary intraflagellar transport (IFT). DYNC2H1 drives retrograde transport of the IFT-A protein complex that regulates tip-to-base transport in cilia, involved in the generation and maintenance of cilia. DYNC2H1 variants or retina-predominant variants cause nonsyndromic retinal degeneration (PMID:32753734). DYNC2H1 mutations also cause asphyxiating thoracic dystrophy and short rib-polydactyly syndrome (PMID: 19442771). DYNC2H1 was localized to the basal bodies by immunofluorescence staining (PMID: 21552265, PMID: 26077881, PMID: 30320547). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30707 Product name: Recombinant human DYNC2H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-196 aa of NM_001377 Sequence: FLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWIEQAHRGNKQISKERAN Predict reactive species Full Name: dynein, cytoplasmic 2, heavy chain 1 Calculated Molecular Weight: 493 kDa Observed Molecular Weight: 493 kDa GenBank Accession Number: NM_001377 Gene Symbol: DYNC2H1 Gene ID (NCBI): 79659 RRID: AB_2935476 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924