Iright
BRAND / VENDOR: Proteintech

Proteintech, 29770-1-AP, ATF7 Polyclonal antibody

CATALOG NUMBER: 29770-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATF7 (29770-1-AP) by Proteintech is a Polyclonal antibody targeting ATF7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29770-1-AP targets ATF7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human lung tissue, mouse lung tissue, human urothelial carcinoma tissue, mouse heart tissue, rat heart tissue, rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30882 Product name: Recombinant human ATF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-167 aa of NM_001366555 Sequence: FKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSL Predict reactive species Full Name: activating transcription factor 7 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 52-60 kDa GenBank Accession Number: NM_001366555 Gene Symbol: ATF7 Gene ID (NCBI): 11016 RRID: AB_3086157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17544 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924