Product Description
Size: 20ul / 150ul
The ATF7 (29770-1-AP) by Proteintech is a Polyclonal antibody targeting ATF7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
29770-1-AP targets ATF7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells
Positive IHC detected in: human lung tissue, mouse lung tissue, human urothelial carcinoma tissue, mouse heart tissue, rat heart tissue, rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30882 Product name: Recombinant human ATF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-167 aa of NM_001366555 Sequence: FKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSL Predict reactive species
Full Name: activating transcription factor 7
Calculated Molecular Weight: 53 kDa
Observed Molecular Weight: 52-60 kDa
GenBank Accession Number: NM_001366555
Gene Symbol: ATF7
Gene ID (NCBI): 11016
RRID: AB_3086157
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P17544
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924