Iright
BRAND / VENDOR: Proteintech

Proteintech, 29772-1-AP, SENP2 Polyclonal antibody

CATALOG NUMBER: 29772-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SENP2 (29772-1-AP) by Proteintech is a Polyclonal antibody targeting SENP2 in WB, IHC, ELISA applications with reactivity to Human samples 29772-1-AP targets SENP2 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: EC109 cells, MKN-45 cells, SGC-7901 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SENP2 (Sentrin-specific protease 2), as a protease, catalyzes two essential functions in the SUMO pathway. The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, SUMO1, SUMO2 and SUMO3 leading to the mature form of the proteins (PMID:15296745). The second is the deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins, by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein (PMID:20194620, PMID:21965678). It has 2 isoforms with the molecular weight of 66 and 68 kDa. Specification Tested Reactivity: Human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30728 Product name: Recombinant human SENP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-228 aa of NM_021627 Sequence: TKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGH Predict reactive species Full Name: SUMO1/sentrin/SMT3 specific peptidase 2 Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 60-68 kDa GenBank Accession Number: NM_021627 Gene Symbol: SENP2 Gene ID (NCBI): 59343 RRID: AB_3086158 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC62 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924