Iright
BRAND / VENDOR: Proteintech

Proteintech, 29778-1-AP, RPGRIP1L Polyclonal antibody

CATALOG NUMBER: 29778-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RPGRIP1L (29778-1-AP) by Proteintech is a Polyclonal antibody targeting RPGRIP1L in WB, ELISA applications with reactivity to Human, mouse, rat samples 29778-1-AP targets RPGRIP1L in WB, IF, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, HEK-293 cells, Jurkat cells, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RPGRIP1L, also named as FTM, KIAA1005, belongs to the RPGRIP1 family. It negatively regulates signaling through the G-protein coupled thromboxane A2 receptor. RPGRIP1L may be involved in mechanisms like programmed cell death, craniofacial development, patterning of the limbs, and formation of the left-right axis.(PMID:17558409) Defects in RPGRIP1L are the cause of Joubert syndrome type 7 (JBTS7). Defects in RPGRIP1L are the cause of Meckel syndrome type 5 (MKS5). Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31168 Product name: Recombinant human RPGRIP1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of NM_015272 Sequence: MSGPTDETAGDLPVKDTGLNLFGMGGLQETSTTRTMKSRQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQL Predict reactive species Full Name: RPGRIP1-like Calculated Molecular Weight: 151 kDa Observed Molecular Weight: 151 kDa GenBank Accession Number: NM_015272 Gene Symbol: RPGRIP1L Gene ID (NCBI): 23322 RRID: AB_2923607 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q68CZ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924