Iright
BRAND / VENDOR: Proteintech

Proteintech, 29782-1-AP, KANK1 Polyclonal antibody

CATALOG NUMBER: 29782-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KANK1 (29782-1-AP) by Proteintech is a Polyclonal antibody targeting KANK1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 29782-1-AP targets KANK1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information KANK1 (KN motif and ankyrin repeat domain-containing protein 1) is involved in the control of cytoskeleton formation by regulating actin polymerization, inhibiting actin fiber formation and cell migration (PMID: 25961457). It inhibits RhoA activity, the formation of lamellipodia but not of filopodia (PMID: 25961457, PMID: 5961457).It also inhibits fibronectin-mediated cell spreading and regulates Rac signaling pathways (PMID: 25961457). Talin-KANK1 interaction controls the recruitment of cortical microtubule stabilizing complexes to focal adhesions (PMID: 27410476). KANK1 can be detected 130-200 kDa (PMID: 15823577, PMID: 33253712, PMID: 35805114). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31422 Product name: Recombinant human KANK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-467 aa of NM_015158 Sequence: ISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKE Predict reactive species Full Name: KN motif and ankyrin repeat domains 1 Calculated Molecular Weight: 147KD Observed Molecular Weight: 130-200 kDa GenBank Accession Number: NM_015158 Gene Symbol: KANK1 Gene ID (NCBI): 23189 RRID: AB_3086160 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924