Iright
BRAND / VENDOR: Proteintech

Proteintech, 29787-1-AP, NSUN7 Polyclonal antibody

CATALOG NUMBER: 29787-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NSUN7 (29787-1-AP) by Proteintech is a Polyclonal antibody targeting NSUN7 in WB, ELISA applications with reactivity to human, mouse, rat samples 29787-1-AP targets NSUN7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information NSUN7 (NOP2/Sun RNA methyltransferase family member 7) is involved in mitochondrial rRNA processing in post-meiotic sperm and is predicted to act upstream of or within flagellated sperm motility and sperm mitochondrion organization. In humans, Nsun7 encodes a protein with 718-amino acid and 3697-bp belonging to the methyltransferase superfamily (PMID: 37173708). The failure to produce NSUN7 would lead to the impairment in activity and motility of sperm flagella, leading to sperm motility deficit and infertility (PMID: 25702163). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31860 Product name: Recombinant human NSUN7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 332-475 aa of BC036568 Sequence: DPDLKTLFTKIGCKNIEILHEKFINIESKDHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYEQLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYSGTLLRQCL Predict reactive species Full Name: NOL1/NOP2/Sun domain family, member 7 Calculated Molecular Weight: 718 aa, 81 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC036568 Gene Symbol: NSUN7 Gene ID (NCBI): 79730 RRID: AB_2923609 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NE18 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924