Proteintech, 29790-1-AP, Trypsin 1/PRSS1 Polyclonal antibody

Size: 20ul / 150ul The Trypsin 1/PRSS1 (29790-1-AP) by Proteintech is a Polyclonal antibody targeting Trypsin 1/PRSS1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 29790-1-AP targets Trypsin 1/PRSS1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PRSS1 encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31383 Product name: Recombinant human PRSS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-140 aa of BC128226 Sequence: IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCL Predict reactive species Full Name: protease, serine, 1 (trypsin 1) Calculated Molecular Weight: 27 kDa GenBank Accession Number: BC128226 Gene Symbol: PRSS1 Gene ID (NCBI): 5644 RRID: AB_3669696 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07477 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.