Proteintech, 29792-1-AP, ABCC5 Polyclonal antibody

Size: 20ul / 150ul The ABCC5 (29792-1-AP) by Proteintech is a Polyclonal antibody targeting ABCC5 in WB, IHC, ELISA applications with reactivity to human samples 29792-1-AP targets ABCC5 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, unboiled HepG2 cells, unboiled MCF-7 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information ABCC5, also named as MOAT-C, pABC11, SMRP, and MRP5, belongs to the ABC transporter superfamily, ABCC family, and Conjugate transporter (TC 3.A.1.208) subfamily. ABCC5 acts as a multispecific organic anion pump that can transport nucleotide analogs. ABCC5 functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that ABCC5 provides resistance to thiopurine anticancer drugs, 6-mercaptopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl) adenine. ABCC5 may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing of this gene has been detected; however, the complete sequence and translation initiation site are unclear. Since it is glycosylated, the apparent molecular weight of ABCC5 could be variable, ranging from 161 kDa to 200 kDa (PMID: 10893247; PMID: 15897250; PMID: 31338999). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31680 Product name: Recombinant human ABCC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of NM_005688 Sequence: MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 5 Calculated Molecular Weight: 161 kDa Observed Molecular Weight: 161-200 kDa GenBank Accession Number: NM_005688 Gene Symbol: ABCC5 Gene ID (NCBI): 10057 RRID: AB_3086162 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.