Iright
BRAND / VENDOR: Proteintech

Proteintech, 29824-1-AP, CCDC111/PRIMPOL Polyclonal antibody

CATALOG NUMBER: 29824-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC111/PRIMPOL (29824-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC111/PRIMPOL in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 29824-1-AP targets CCDC111/PRIMPOL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CCDC111, also known as PRIMPOL, FLJ33167, which contains the active-site motifs of AEP primases and a putative Zn finger similar to that of herpesvirus UL52 primase and other AEP-like enzymes. CCDC111 is required to facilitate mitochondrial and nuclear replication fork progression by initiating de novo DNA synthesis using dNTPs and acting as an error-prone DNA polymerase able to bypass certain DNA lesions (PMID: 24126761, PMID: 24207056). In addition to its role in DNA damage response, also required to maintain efficient nuclear and mitochondrial DNA replication in unperturbed cells (Uniprot, PMID: 30715459). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31478 Product name: Recombinant human CCDC111 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-560 aa of BC064600 Sequence: EVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQNKQKGVGYFNSIGTSVETIEGFQCSPYPEVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEVCLLFLFKEEEEFTTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE Predict reactive species Full Name: coiled-coil domain containing 111 Observed Molecular Weight: 64 kDa GenBank Accession Number: BC064600 Gene Symbol: CCDC111/PRIMPOL Gene ID (NCBI): 201973 RRID: AB_2918349 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LW4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924