Iright
BRAND / VENDOR: Proteintech

Proteintech, 29848-1-AP, BNIP3L Polyclonal antibody

CATALOG NUMBER: 29848-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BNIP3L (29848-1-AP) by Proteintech is a Polyclonal antibody targeting BNIP3L in WB, ELISA applications with reactivity to human samples 29848-1-AP targets BNIP3L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, mouse brain cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information BNIP3L (also known as NIX) is a mitochondrial outer-membrane protein that belongs to the BH3-only subgroup of the BCL-2 family. Initially identified as a weak pro-apoptotic factor, it has emerged as a key mitophagy receptor that bridges damaged or surplus mitochondria to the autophagosome, thereby safeguarding mitochondrial quality and cellular homeostasis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31514 Product name: Recombinant human BNIP3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-146 aa of BC001559 Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS Predict reactive species Full Name: BCL2/adenovirus E1B 19kDa interacting protein 3-like Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC001559 Gene Symbol: BNIP3L Gene ID (NCBI): 665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60238 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924