Iright
BRAND / VENDOR: Proteintech

Proteintech, 29864-1-AP, ADRB2 Polyclonal antibody

CATALOG NUMBER: 29864-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADRB2 (29864-1-AP) by Proteintech is a Polyclonal antibody targeting ADRB2 in WB, ELISA applications with reactivity to human samples 29864-1-AP targets ADRB2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, ACHN cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information Beta-2 adrenergic receptor (ADRB2), a member of the G protein-coupled receptor (GPCR) family, binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. ADRB2 is directly linked to one of its final effectors, the class C L-type Ca2+ channel, Cav1.2 (PMID: 11441182). This receptor-channel complex also contains a G protein, an adenylyl cyclase, cyclic adenosine monophosphate-dependent protein kinase (PKA), and a counteracting phosphatase, PP2A. Different polymorphic forms, point mutations, and/or downregulation of the gene of ADRB2 are associated with nocturnal asthma, obesity, and type 2 diabetes. This antibody detects ADRB2 with a molecular weight of 46-48 kDa, as has been shown by some researches (PMID: 30542705; 35075132). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32313 Product name: Recombinant human ADRB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-413 aa of BC012481 Sequence: PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL Predict reactive species Full Name: adrenergic, beta-2-, receptor, surface Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46-48 kDa GenBank Accession Number: BC012481 Gene Symbol: ADRB2 Gene ID (NCBI): 154 RRID: AB_2923616 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07550 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924