Proteintech, 29885-1-AP, MGC33407/ACTL9 Polyclonal antibody

Size: 20ul / 150ul The MGC33407/ACTL9 (29885-1-AP) by Proteintech is a Polyclonal antibody targeting MGC33407/ACTL9 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 29885-1-AP targets MGC33407/ACTL9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle Positive IHC detected in: human liver tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ACTL9 (Actin Like 9), also named MGC33407, encodes a testis-specific actin-like protein that plays a role in fusion of proacrosomal vesicles and perinuclear theca formation (PMID: 33626338). ACTL9 protein contains 416 amino acids, which mainly localizes in the equatorial segment of human sperm head (PubMed: 33626338). Diseases associated with ACTL9 include spermatogenic failure and non-syndromic male infertility. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31805 Product name: Recombinant human MGC33407 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-172 aa of BC024028 Sequence: MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDSPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPELTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAFESLRS Predict reactive species Full Name: hypothetical protein MGC33407 Observed Molecular Weight: 45 kDa GenBank Accession Number: BC024028 Gene Symbol: ACTL9 Gene ID (NCBI): 284382 RRID: AB_2923617 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TC94 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.