Iright
BRAND / VENDOR: Proteintech

Proteintech, 29921-1-AP, OTUD1 Polyclonal antibody

CATALOG NUMBER: 29921-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OTUD1 (29921-1-AP) by Proteintech is a Polyclonal antibody targeting OTUD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 29921-1-AP targets OTUD1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse colon tissue, A549 cells Positive IHC detected in: human cervical cancer tissue, human ovary tumor tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information OTUD1, OTU domain-containing protein 1, is a deubiquitinating enzyme that specifically hydrolyzes 'Lys-63'-linked polyubiquitin to monoubiquitin (PMID: 23827681). OTUD1-mediated deubiquitination prevents activation of the ribosome quality control and subsequent dissociation of ribosomes and stimulates formation of polysomes and translation (PMID: 36445135). OTUD1 is a colon-specific deubiquitinase that expressed in normal colonic epithelium goblet cells (PMID: 36910614). Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31996 Product name: Recombinant human OTUD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 272-431 aa of Sequence: SSAAEPVIVSRSDPRDEKLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGH Predict reactive species Full Name: OTU domain containing 1 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 50-55 kDa Gene Symbol: OTUD1 Gene ID (NCBI): 220213 RRID: AB_3086190 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VV17 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924