Proteintech, 29928-1-AP, M-cadherin Polyclonal antibody

Size: 20ul / 150ul The M-cadherin (29928-1-AP) by Proteintech is a Polyclonal antibody targeting M-cadherin in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 29928-1-AP targets M-cadherin in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells Positive IF-P detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. M-cadherin (muscle cadherin), also known as CDH15 (cadherin-15), is a 124-kDa type I transmembrane glycoprotein that is highly expressed in developing skeletal muscle, satellite cells, and cerebellum (PMID: 9545347; 12052883). It associates with β-catenin and functions as a cell-cell adhesion molecule in a homophilic and specific manner (PMID: 9545347). M-cadherin is part of the myogenic program and may provide a trigger for terminal muscle differentiation (PMID: 1840697). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25763 Product name: Recombinant human CDH15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-450 aa of BC008951 Sequence: AFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVEDRDLPGSPNWVARFTILEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYR Predict reactive species Full Name: cadherin 15, type 1, M-cadherin (myotubule) Calculated Molecular Weight: 89 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC008951 Gene Symbol: M-cadherin Gene ID (NCBI): 1013 RRID: AB_3086192 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55291 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.