Proteintech, 29948-1-AP, ADAM17 Polyclonal antibody

Size: 20ul / 150ul The ADAM17 (29948-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM17 in WB, ELISA applications with reactivity to human, mouse samples 29948-1-AP targets ADAM17 in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HUVEC cells, MCF-7 cells, SKOV-3 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32418 Product name: Recombinant human ADAM17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 693-824 aa of BC136783 Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC Predict reactive species Full Name: ADAM metallopeptidase domain 17 Calculated Molecular Weight: 824 aa, 93 kDa Observed Molecular Weight: 90-110 kDa GenBank Accession Number: BC136783 Gene Symbol: ADAM17 Gene ID (NCBI): 6868 RRID: AB_2935490 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78536 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.