Iright
BRAND / VENDOR: Proteintech

Proteintech, 29965-1-AP, PCDH19 Polyclonal antibody

CATALOG NUMBER: 29965-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCDH19 (29965-1-AP) by Proteintech is a Polyclonal antibody targeting PCDH19 in WB, ELISA applications with reactivity to human, mouse, rat samples 29965-1-AP targets PCDH19 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PCDH19 is a transmembrane protein and member of the protocadherin family. It is encoded by the X-chromosome and more than 200 mutations have been linked to the neurodevelopmental PCDH-clustering epilepsy (PCDH19-CE) syndrome. PCDH19 is a member of the non-clustered δ2-type protocadherins, has 6 cadherin repeats in the extracellular part, and a cytoplasmic tail containing two conserved domains (CM1 and CM2) (PMID: 36389226). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32302 Product name: Recombinant human PCDH19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 850-1040 aa of NM_001105243.1 Sequence: HHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLEGNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPDHDQNEGFHCREECRILGHSDRCWMPRNPMPIRSKSPEHVRNIIALSIEATAADVEAYDDCGPTKRTFATFGKDVSDHPAEERPTLKGKRTVD* Predict reactive species Full Name: protocadherin 19 Calculated Molecular Weight: 126 kDa Observed Molecular Weight: 126 kDa GenBank Accession Number: NM_001105243.1 Gene Symbol: PCDH19 Gene ID (NCBI): 57526 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAB3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924