Proteintech, 29971-1-AP, TRPV3 Polyclonal antibody

Size: 20ul / 150ul The TRPV3 (29971-1-AP) by Proteintech is a Polyclonal antibody targeting TRPV3 in IHC, ELISA applications with reactivity to Human samples 29971-1-AP targets TRPV3 in IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Transient receptor potential cation channel, subfamily V, member 3, also known as TRPV3, is a human gene encoding the protein of the same name. The TRPV3 protein belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of human sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. The TRPV3 channel has wide tissue expression that is especially high in the skin (keratinocytes) but also in the brain. It functions as a molecular sensor for innocuous warm temperatures.( PMID 12016205) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32437 Product name: Recombinant human TRPV3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 671-790 aa of NM_001258205 Sequence: NMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV Predict reactive species Full Name: transient receptor potential cation channel, subfamily V, member 3 Calculated Molecular Weight: 91kd GenBank Accession Number: NM_001258205 Gene Symbol: TRPV3 Gene ID (NCBI): 162514 RRID: AB_3086200 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NET8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.