Iright
BRAND / VENDOR: Proteintech

Proteintech, 29988-1-AP, KCNS1 Polyclonal antibody

CATALOG NUMBER: 29988-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNS1 (29988-1-AP) by Proteintech is a Polyclonal antibody targeting KCNS1 in WB, ELISA applications with reactivity to Human, rat samples 29988-1-AP targets KCNS1 in WB, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, THP-1 cells, U-87 MG cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31380 Product name: Recombinant human KCNS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-526 aa of BC075033 Sequence: VTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQEFEDLLSSVDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY Predict reactive species Full Name: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1 Calculated Molecular Weight: 526 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC075033 Gene Symbol: KCNS1 Gene ID (NCBI): 3787 RRID: AB_3086205 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KK3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924