Iright
BRAND / VENDOR: Proteintech

Proteintech, 29998-1-AP, MBD1 Polyclonal antibody

CATALOG NUMBER: 29998-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MBD1 (29998-1-AP) by Proteintech is a Polyclonal antibody targeting MBD1 in WB, IF/ICC, ELISA applications with reactivity to human samples 29998-1-AP targets MBD1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IF/ICC detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information MBD1, also known as RFT, PCM1, CXXC3, is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). MBD1 is a transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. MBD1 acts as a transcriptional repressor and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as the histone methyltransferase SETDB1. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. Isoform 1 and isoform 2 can repress transcription from unmethylated promoters (PMID: 12665582, 14610093, 16757475). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31424 Product name: Recombinant human MBD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 393-605 aa of NM_015846 Sequence: SEDGAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ Predict reactive species Full Name: methyl-CpG binding domain protein 1 Calculated Molecular Weight: 67KD Observed Molecular Weight: 70-80 kDa GenBank Accession Number: NM_015846 Gene Symbol: MBD1 Gene ID (NCBI): 4152 RRID: AB_2935497 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UIS9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924