Proteintech, 30007-1-AP, LGR5 Polyclonal antibody

Size: 20ul / 150ul The LGR5 (30007-1-AP) by Proteintech is a Polyclonal antibody targeting LGR5 in WB, ELISA applications with reactivity to human, mouse, rat samples 30007-1-AP targets LGR5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BGC-823 cells, mouse brain tissue, HEK-293 cells, SGC-7901 cells, SKOV-3 cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5) also known as G-protein coupled receptor 49 (GPR49) or G-protein coupled receptor 67 (GPR67) is a protein that in humans is encoded by the LGR5 gene. It is a member of GPCR class A receptor proteins. R-spondin proteins are the biological ligands of LGR5. LGR5 is expressed across a diverse range of tissue such as in the muscle, placenta, spinal cord and brain and particularly as a biomarker of adult stem cells in certain tissues.LGR5 is crucial during embryogenesis as LGR null studies in mice incurred 100% neonatal mortality accompanied by several craniofacial distortions such as ankyloglossia and gastrointestinal dilation (PMID: 9642114, 16575208, 525477). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31625 Product name: Recombinant human LGR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 824-907 aa of BC096324 Sequence: NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL Predict reactive species Full Name: leucine-rich repeat-containing G protein-coupled receptor 5 Calculated Molecular Weight: 907 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC096324 Gene Symbol: LGR5 Gene ID (NCBI): 8549 RRID: AB_3086207 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75473 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.