Iright
BRAND / VENDOR: Proteintech

Proteintech, 30046-1-AP, BAHCC1 Polyclonal antibody

CATALOG NUMBER: 30046-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BAHCC1 (30046-1-AP) by Proteintech is a Polyclonal antibody targeting BAHCC1 in IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 30046-1-AP targets BAHCC1 in IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, rat brain tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BAHCC1 (BAH and coiled-coil domain-containing protein 1) is also named as BAHD2, KIAA1447 and BAH domain-containing protein 2. BAHCC1 is a transcriptional regulator controlling expression of E2F/KLF-dependent cell-cycle and DNA-repair genes. BAHCC1 associates with BRG1-containing remodeling complexes at the promoters of these genes. BAHCC1 silencing leads to decreased cell proliferation and delayed DNA repair. Consequently, BAHCC1 deficiency cooperates with PARP inhibition to induce melanoma cell death (PMID: 37924516). depletion of BAHCC1, or disruption of the BAHCC1BAH-H3K27me3 interaction, causes derepression of H3K27me3-targeted genes that are involved in tumor suppression and cell differentiation, leading to suppression of oncogenesis (PMID: 33139953). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32599 Product name: Recombinant human BAHCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1518-1614 aa of NM_001291324.1 Sequence: SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAK Predict reactive species Full Name: BAH domain and coiled-coil containing 1 Calculated Molecular Weight: 280 kDa Observed Molecular Weight: 280 kDa GenBank Accession Number: NM_001291324.1 Gene Symbol: BAHCC1 Gene ID (NCBI): 57597 RRID: AB_3086218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P281 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924