Product Description
Size: 20ul / 150ul
The CDK10 (30061-1-AP) by Proteintech is a Polyclonal antibody targeting CDK10 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples
30061-1-AP targets CDK10 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: A431 cells, K-562 cells, THP-1 cells, U2OS cells, C2C12 cells
Positive IF/ICC detected in: hTERT-RPE1 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Cyclin-dependent kinase 10 (CDK10) is a Cdc2-related kinase that was discovered based on its homology to the Cdc2 PSTA1RE amino acid domain (PMID: 8208557). CDK10 plays a pivotal role in the regulation of fundamental cellular processes, including cell proliferation, transcription regulation, and cell cycle regulation. It partners with cyclin M to phosphorylate substrates such as ETS2 and PKN2 in order to modulate cellular growth. Initial reports have indicated that CDK10 may act as a tumor suppressor in breast cancer (PMID: 26392360). Additional studies have demonstrated tumor suppressive and oncogenic roles for CDK10 in malignancies such as hepatobiliary cancers, gastric cancer, glioma, nasopharyngeal carcinoma, and colorectal cancer(PMID: 22326270, PMID: 29512714, PMID: 23740091, PMID: 29845196)
Specification
Tested Reactivity: human, mouse
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30365 Product name: Recombinant human CDK10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 190-283 aa of BC017342 Sequence: NIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLFMATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPATSEGQSKRCKP Predict reactive species
Full Name: cyclin-dependent kinase 10
Calculated Molecular Weight: 283 aa, 32 kDa
Observed Molecular Weight: 38 kDa
GenBank Accession Number: BC017342
Gene Symbol: CDK10
Gene ID (NCBI): 8558
RRID: AB_2935507
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q15131
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924