Iright
BRAND / VENDOR: Proteintech

Proteintech, 30062-1-AP, WDR4 Polyclonal antibody

CATALOG NUMBER: 30062-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDR4 (30062-1-AP) by Proteintech is a Polyclonal antibody targeting WDR4 in WB, ELISA applications with reactivity to human, mouse, rat samples 30062-1-AP targets WDR4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30580 Product name: Recombinant human WDR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 128-266 aa of BC001074 Sequence: DARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC Predict reactive species Full Name: WD repeat domain 4 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC001074 Gene Symbol: WDR4 Gene ID (NCBI): 10785 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57081 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924