Iright
BRAND / VENDOR: Proteintech

Proteintech, 30118-1-AP, BST2 Polyclonal antibody

CATALOG NUMBER: 30118-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BST2 (30118-1-AP) by Proteintech is a Polyclonal antibody targeting BST2 in WB, IF-P, ELISA applications with reactivity to Human, mouse samples 30118-1-AP targets BST2 in WB, IF-P, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IF-P detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information BST2, also named as CD317 and Tetherin, belongs to the tetherin family. It may be involved in the sorting of secreted proteins and it is involved in pre-B-cell growth. BST2 is an antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. BST2 may play a role in B-cell activation in rheumatoid arthritis. It is recently identified interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. BST2 is a plasma membrane proteins, tetherin inhibits virion particle release from infected cells. BST2 is effective against retroviruses and flavoviruses whilst IFITMs disrupt influenza and flavivirus infection. Observed MW of BST2 is 30-36 kDa (PMID: 19196977; 21237475). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32333 Product name: Recombinant human BST2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 49-161 aa of BC033873 Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS Predict reactive species Full Name: bone marrow stromal cell antigen 2 Calculated Molecular Weight: 180 aa, 20 kDa Observed Molecular Weight: 30-36 kDa, 50-70 kDa GenBank Accession Number: BC033873 Gene Symbol: BST2 Gene ID (NCBI): 684 RRID: AB_3086236 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q10589 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924