Iright
BRAND / VENDOR: Proteintech

Proteintech, 30119-1-AP, RIF1 Polyclonal antibody

CATALOG NUMBER: 30119-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RIF1 (30119-1-AP) by Proteintech is a Polyclonal antibody targeting RIF1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples 30119-1-AP targets RIF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HEK-293T cells, HT-29 cells, HeLa cells, HepG2 cells, MCF-7 cells Positive IHC detected in: human cervical cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:600-1:2400 Background Information RIF1 (Rap1-interacting factor 1) is a multifunctional chromosome stability protein implicated in controlling DNA replication and repair. Human RIF1 can interact with protein phosphatase 1 (PP1) and the interaction is crucial for controlling DNA replication by limiting phosphorylation of the MCM complex (PMID: 28077461). RIF1 also acts with PP1 to protect nascent DNA from overdegradation at stalled replication forks (PMID: 31141682). RIF1 promotes non-homologous end joining (NHEJ) in double strand break (DSB) repair (PMID: 30443189). Research studies show that RIF1 is overexpressed in breast cancer tissues and is upgraded in NSCLC tissues (PMID: 30237512). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32422 Product name: Recombinant human RIF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2277-2472 aa of NM_001177663.1 Sequence: SEMAKESIPCPTESVYPPLVNCVAPVDIILPQITSNMWARGLGQLIRAKNIKTIGDLSTLTASEIKTLPIRSPKVSNVKKALRIYHEQQVKTRGLEEIPVFDISEKTVNGIENKSLSPDEERLVSDIIDPVALEIPLSKNLLAQISALALQLDSEDLHNYSGSQLFEMHEKLSCMANSVIKNLQSRWRSPSHENSI Predict reactive species Full Name: RAP1 interacting factor homolog (yeast) Calculated Molecular Weight: 274 kDa Observed Molecular Weight: 300 kDa GenBank Accession Number: NM_001177663.1 Gene Symbol: RIF1 Gene ID (NCBI): 55183 RRID: AB_2935516 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5UIP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924