Iright
BRAND / VENDOR: Proteintech

Proteintech, 30140-1-AP, KIAA1797 Polyclonal antibody

CATALOG NUMBER: 30140-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIAA1797 (30140-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA1797 in WB, ELISA applications with reactivity to Human, mouse, rat samples 30140-1-AP targets KIAA1797 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, Neuro-2a cells, SH-SY5Y cells, U-251 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information KIAA1797 is a novel component of the focal adhesion complex expressed in glial and neuronal cells with a tumour suppressor function in gliomas, which is also named 'focadhesin' (PMID: 22427331). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31233 Product name: Recombinant human KIAA1797 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 230-502 aa of BC001246 Sequence: LLSEATGKIFDLLPNKIRRKDLELYISIAKCLLEMTDDDANRIAQVTKSNIEKAAFVKLYLVSQGRFPLVNLTDMLSVAVQHREKEVLAWMILHSLYQARIVSHANTGVLKRMEWLLELMGYIRNVAYQSTSFHNTALDEALDFFLLIFATAVVAWADHTAPLLLGLSASWLPWHQENGPAGPVPSFLGRSPMHRVTLQEVLTLLPNSMALLLQKEPWKEQTQKFIDWLFSIMESPKEALSAQSRDLLKATLLSLRVLPEFKKKAVWTRAYGW Predict reactive species Full Name: KIAA1797 Observed Molecular Weight: 160-170 kDa GenBank Accession Number: BC001246 Gene Symbol: KIAA1797 Gene ID (NCBI): 54914 RRID: AB_3086244 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VW36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924