Iright
BRAND / VENDOR: Proteintech

Proteintech, 30145-1-AP, MLKL Polyclonal antibody

CATALOG NUMBER: 30145-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MLKL (30145-1-AP) by Proteintech is a Polyclonal antibody targeting MLKL in WB, IF/ICC, ELISA applications with reactivity to mouse, rat samples 30145-1-AP targets MLKL in WB, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HSC-T6 cells, 4T1 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Mixed lineage kinase domain-like pseudokinase (Mlkl) belongs to the protein kinase superfamily and has two MWs of 54 and 30 kDa. Mlkl plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (RIP3), which is a key signaling molecule in the necroptosis pathway. High levels of this protein and RIP3 are associated with inflammatory bowel disease in children. Specification Tested Reactivity: mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32514 Product name: Recombinant mouse Mlkl protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_001310613 Sequence: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKT Predict reactive species Full Name: mixed lineage kinase domain-like Calculated Molecular Weight: 54kd Observed Molecular Weight: 54 kDa GenBank Accession Number: NM_001310613 Gene Symbol: Mlkl Gene ID (NCBI): 74568 RRID: AB_3086246 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9D2Y4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924