Iright
BRAND / VENDOR: Proteintech

Proteintech, 30153-1-AP, ADCY5 Polyclonal antibody

CATALOG NUMBER: 30153-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADCY5 (30153-1-AP) by Proteintech is a Polyclonal antibody targeting ADCY5 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 30153-1-AP targets ADCY5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ADCY5 belongs to the adenylate cyclase (ADCY) superfamily which is a group of glycoproteins regulating intracellular signaling (PMID: 35832555). ADCY5 is expressed only in neurons and all neurons express ADCY5 (PMID: 31970214). Gain-of-function mutations in ADCY5 is linked to a rare movement-onset disorder called ADCY5-related dyskinesia (PMID: 32627162). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32812 Product name: Recombinant human ADCY5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-195 aa of NM_183357 Sequence: MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGAVTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRRGAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEGGEGSGDGGSSADSGS Predict reactive species Full Name: adenylate cyclase 5 Calculated Molecular Weight: 139 kDa GenBank Accession Number: NM_183357 Gene Symbol: ADCY5 Gene ID (NCBI): 111 RRID: AB_3086248 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95622 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924