Iright
BRAND / VENDOR: Proteintech

Proteintech, 30156-1-AP, LRRC50 Polyclonal antibody

CATALOG NUMBER: 30156-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LRRC50 (30156-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC50 in IHC, IF-P, ELISA applications with reactivity to Human, mouse samples 30156-1-AP targets LRRC50 in IHC, IF-P, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information LRRC50 is a cilium-specific protein required for the stability of the ciliary architecture, it plays a role in cytoplasmic preassembly of dynein arms. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32822 Product name: Recombinant human LRRC50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 522-680 aa of BC024009 Sequence: FVTELDGTRTEDLETIRLETKETCCIDDLPDLEDDDETGKSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFKKEAKRDSEIRKQDTKSPRPLIQELSDEDPSGQPLMPPTCQRDAAPLTSTGDRDS Predict reactive species Full Name: leucine rich repeat containing 50 Calculated Molecular Weight: 725 aa, 80 kDa GenBank Accession Number: BC024009 Gene Symbol: LRRC50 Gene ID (NCBI): 123872 RRID: AB_3086249 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEP3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924