Iright
BRAND / VENDOR: Proteintech

Proteintech, 30168-1-AP, HIV-1-P24 Polyclonal antibody

CATALOG NUMBER: 30168-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HIV-1-P24 (30168-1-AP) by Proteintech is a Polyclonal antibody targeting HIV-1-P24 in WB, ELISA applications with reactivity to recombinant protein samples 30168-1-AP targets HIV-1-P24 in WB, ELISA applications and shows reactivity with recombinant protein samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The HIV virus is composed of core RNA, capsid, and the outermost envelope. Among them, the capsid is only composed of P24 protein, which is the product of structural gene GAG. GAG encodes a 55kda GAG protein P55, which is cleaved into capsid P24 by protease H. P24 surrounds the core genomic RNA of the HIV virus particles, forming a firm conical nucleocapsid complex. In addition, due to the high conservativeness of the GAG gene sequence, the P24 protein amino acid sequence is also highly conservative in different strains of HIV, so it can be used as a detection of antigen in HIV infection. Specification Tested Reactivity: recombinant protein Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32891 Product name: Recombinant hiv-1 HIV-1-P24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-363 aa of NP_057850 Sequence: PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL Predict reactive species Full Name: Gag polyprotein Calculated Molecular Weight: 24 kDa GenBank Accession Number: NP_057850 Gene Symbol: HIV-1-P24 Gene ID (NCBI): 155030 RRID: AB_2935522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04591 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924