Iright
BRAND / VENDOR: Proteintech

Proteintech, 30194-1-AP, IL-1RL1/ST2 Polyclonal antibody

CATALOG NUMBER: 30194-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-1RL1/ST2 (30194-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1RL1/ST2 in WB, FC, ELISA applications with reactivity to human samples 30194-1-AP targets IL-1RL1/ST2 in WB, FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, human placenta tissue Positive FC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information ST2, also known as IL1RL1, is a member of the IL-1 superfamily and serves as the receptor for IL-33. It plays a major role in immune and inflammatory responses. ST2 is expressed by various types of immune cells including Th2 cells, mast cells, type 2 innate lymphoid cells, eosinophils, basophils, NK cells, and non-immune cells, including cardiomyocytes. Two forms of ST2 exist: a membrane-bound form and a soluble form (sST2). The membrane-bound form activates the MyD88/NF-κB signaling pathway to enhance mast cell, Th2, regulatory T cell (Treg), and innate lymphoid cell type 2 functions. sST2 acts as a decoy receptor. (PMID: 27055914; 23999434; 28484466) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0116 Product name: Recombinant Human ST2/IL-1 RL1 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 19-328 aa of BC030975 Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF Predict reactive species Full Name: interleukin 1 receptor-like 1 Calculated Molecular Weight: 63 kDa, 37 kDa, 30 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC030975 Gene Symbol: IL1RL1 Gene ID (NCBI): 9173 RRID: AB_3086259 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01638 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924