Proteintech, 30214-1-AP, ACSL3 Polyclonal antibody

Size: 20ul / 150ul The ACSL3 (30214-1-AP) by Proteintech is a Polyclonal antibody targeting ACSL3 in WB, IP, ELISA applications with reactivity to Human, mouse samples 30214-1-AP targets ACSL3 in WB, IP, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: DU 145 cells, HuH-7 cells, LNCaP cells, MKN-45 cells, mouse kidney tissue Positive IP detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ACSL3, also named as ACS3, FACL3 and LACS3, belongs to the ATP-dependent AMP-binding enzyme family. Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 mediates hepatic lipogenesis. Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates. Has mainly an anabolic role in energy metabolism. Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins). The antibody is specific to ACSL3. Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33005 Product name: Recombinant human ACSL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 602-675 aa of BC041692 Sequence: KNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFE Predict reactive species Full Name: acyl-CoA synthetase long-chain family member 3 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC041692 Gene Symbol: ACSL3 Gene ID (NCBI): 2181 RRID: AB_2935532 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95573 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.