Iright
BRAND / VENDOR: Proteintech

Proteintech, 30215-1-AP, TBXAS1 Polyclonal antibody

CATALOG NUMBER: 30215-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TBXAS1 (30215-1-AP) by Proteintech is a Polyclonal antibody targeting TBXAS1 in WB, IHC, ELISA applications with reactivity to human samples 30215-1-AP targets TBXAS1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, THP-1 cells Positive IHC detected in: human ovary cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TBXAS1 catalyzes the conversion of the prostaglandin endoperoxide into thromboxane A2 as a potent vasoconstrictor and inducer of platelet aggregation. It was identified as a novel airway fibroblast-specific marker with integrin-8 (ITGA8) (PMID:20435685). It was observed in the epithelium. It is a monomer with a molecular weight of 60 kDa. It also has two variants with 60.5 kDa and 52.3 kDa (PMID:1730669). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30950 Product name: Recombinant human TBXAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-267 aa of BC014117 Sequence: NKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQ Predict reactive species Full Name: thromboxane A synthase 1 (platelet) Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC014117 Gene Symbol: TBXAS1 Gene ID (NCBI): 6916 RRID: AB_3086266 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24557 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924