Iright
BRAND / VENDOR: Proteintech

Proteintech, 30216-1-AP, IL-1 alpha Polyclonal antibody

CATALOG NUMBER: 30216-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-1 alpha (30216-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1 alpha in WB, ELISA applications with reactivity to mouse samples 30216-1-AP targets IL-1 alpha in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: LPS treated RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0263 Product name: Recombinant mouse IL1-alpha protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 115-270 aa of NM_010554 Sequence: MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS Predict reactive species Full Name: interleukin 1 alpha Calculated Molecular Weight: 31kd Observed Molecular Weight: 31 kDa GenBank Accession Number: NM_010554 Gene Symbol: Il1a Gene ID (NCBI): 16175 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01582 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924