Proteintech, 30236-1-AP, QRICH1 Polyclonal antibody

Size: 20ul / 150ul The QRICH1 (30236-1-AP) by Proteintech is a Polyclonal antibody targeting QRICH1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30236-1-AP targets QRICH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, Jurkat cells, NIH/3T3 cells Positive IHC detected in: mouse testis tissue, rat brain tissue, human colon cancer tissue, human lung cancer tissue, mouse brain tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Glutamine-rich protein 1 (QRICH1) is a transcriptional regulator that acts as a mediator of the integrated stress response (ISR) through transcriptional control of protein homeostasis under conditions of ER stress (PMID:33384352). QRICH1 is a member of the caspase recruitment domain (CARD)-containing gene family, which encodes for proteins implicated in regulation of caspase activation in the context of apoptosis and inflammation, and in regulation of NF-κB signaling(PMID:33384352). QRICH1 can be modified by phosphorylation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31997 Product name: Recombinant human QRICH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC110855 Sequence: MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQLSPQLTVHQPTEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQIQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTASVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATGT Predict reactive species Full Name: glutamine-rich 1 Observed Molecular Weight: 85-110 kDa GenBank Accession Number: BC110855 Gene Symbol: QRICH1 Gene ID (NCBI): 54870 RRID: AB_3086273 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2TAL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.