Proteintech, 30246-1-AP, C16orf74 Polyclonal antibody

Size: 20ul / 150ul The C16orf74 (30246-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf74 in WB, IHC, ELISA applications with reactivity to human samples 30246-1-AP targets C16orf74 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, SW 1990 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The C16orf74 has been reported associated with tumor necrosis factor (TNF)-alpha as well as hypoxic condition. Moreover, several reports have indicated that C16orf74 expression is a potential prognostic factor in several types of cancer. The results of several genome-wide studies have indicated that C16orf74 is involved in inflammatory processes. C16orf74 is overexpressed in the vast majority of human PDAC(Clinical outcome of pancreatic ductal adenocarcinoma), and likely plays a significant role in pancreatic cell growth and invasion through its interaction with PPP3CA. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32878 Product name: Recombinant human C16orf74 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-76 aa of BC009078 Sequence: GFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDPEA Predict reactive species Full Name: chromosome 16 open reading frame 74 Observed Molecular Weight: 15 - 20 kDa GenBank Accession Number: BC009078 Gene Symbol: C16orf74 Gene ID (NCBI): 404550 RRID: AB_3086278 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96GX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.