Iright
BRAND / VENDOR: Proteintech

Proteintech, 30251-1-AP, CRTAC1 Polyclonal antibody

CATALOG NUMBER: 30251-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRTAC1 (30251-1-AP) by Proteintech is a Polyclonal antibody targeting CRTAC1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 30251-1-AP targets CRTAC1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: human plasma, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CRTAC1 (Cartilage acidic protein 1) is also named as ASPIC and 68 kDa chondrocyte-expressed protein (CEP-68). Cartilage acidic protein 1 (CRTAC1), a novel human marker which allowed discrimination of human chondrocytes from osteoblasts and mesenchymal stem cells (PMID: 17074475). CRTAC1 is a glycosylated calcium-binding extracellular matrix protein (PMID: 37796703). CRTAC1 acquired an alternate last exon from the tail-to-tail oriented neighbouring gene in humans resulting in the glycosylated isoform CRTAC1-A which represents a new extracellular matrix molecule of articular cartilage (PMID: 17074475). CRTAC1 was downregulated in bladder cancer tissues and cells (PMID: 34818994). Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32963 Product name: Recombinant human CRTAC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-332 aa of BC034245 Sequence: VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP Predict reactive species Full Name: cartilage acidic protein 1 Calculated Molecular Weight: 661 aa, 71 kDa Observed Molecular Weight: 71-100 kDa GenBank Accession Number: BC034245 Gene Symbol: CRTAC1 Gene ID (NCBI): 55118 RRID: AB_3086281 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924