Proteintech, 30285-1-AP, LILRA2 Polyclonal antibody

Size: 20ul / 150ul The LILRA2 (30285-1-AP) by Proteintech is a Polyclonal antibody targeting LILRA2 in WB, ELISA applications with reactivity to Human samples 30285-1-AP targets LILRA2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32652 Product name: Recombinant human LILRA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-110 aa of BC017412 Sequence: LYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSD Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 Calculated Molecular Weight: 466 aa, 51 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC017412 Gene Symbol: LILRA2 Gene ID (NCBI): 11027 RRID: AB_2935537 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N149 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.