Proteintech, 30302-1-AP, OGG1 Polyclonal antibody

Size: 20ul / 150ul The OGG1 (30302-1-AP) by Proteintech is a Polyclonal antibody targeting OGG1 in WB, ELISA applications with reactivity to human, rat samples 30302-1-AP targets OGG1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A549 cells, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The DNA damages induced by ROS contain base modification, base loss, and DNA single strand breaks, which are usually repaired by the base excision repair (BER) pathway in both prokaryotes and eukaryotes. OGG1 (The human 8-oxoguanine glycosylase 1) is the primary enzyme in BER pathway, responsible for the excision of 7, 8-dihydro-8-oxoguanine (8-oxoG), a mutagenic base byproduct that occurs as a result of exposure to reactive oxygen species. There's 8 isoforms of OGG1, with calculated MW 22 kDa, 36-40 kDa and 45-57 kDa. The difference among these isoforms is the C-terminal (317-345aa). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32962 Product name: Recombinant human OGG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC000657 Sequence: MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYF Predict reactive species Full Name: 8-oxoguanine DNA glycosylase Calculated Molecular Weight: 22 kDa, 36-40 kDa, 45-57 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC000657 Gene Symbol: OGG1 Gene ID (NCBI): 4968 RRID: AB_2935539 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15527 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.