Proteintech, 30408-1-AP, MUC5AC Polyclonal antibody

Size: 20ul / 150ul The MUC5AC (30408-1-AP) by Proteintech is a Polyclonal antibody targeting MUC5AC in WB, IHC, ELISA applications with reactivity to human samples 30408-1-AP targets MUC5AC in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information MUC5AC (Mucin-5AC ) is a gel-forming glycoprotein of the gastric and respiratory epithelium. It can protect mucous membranes from infection and chemical damage by binding to inhaled microorganisms and particles, which are then cleared by the mucociliary system. (PubMed:14535999,PubMed:14718370) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30190 Product name: Recombinant human MUC5AC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5545-5654 aa of NM_001304359 Sequence: GCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQHSEEAEPEPSQEAESGSWERGVPVSPMH Predict reactive species Full Name: mucin 5AC, oligomeric mucus/gel-forming Calculated Molecular Weight: 586 kDa Observed Molecular Weight: 290 kDa GenBank Accession Number: NM_001304359 Gene Symbol: MUC5AC Gene ID (NCBI): 4586 RRID: AB_3669718 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P98088 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.