Proteintech, 30452-1-AP, ERBB3 Polyclonal antibody

Size: 20ul / 150ul The ERBB3 (30452-1-AP) by Proteintech is a Polyclonal antibody targeting ERBB3 in WB, ELISA applications with reactivity to human samples 30452-1-AP targets ERBB3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-453s cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information V-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (ErbB-3, HER3) is a member of the EGF receptor tyrosine kinase family including EGFR (HER1), Neu (ErbB-2, HER2), ErbB-3 (HER3), and ErbB-4 (HER4) that are frequently overexpressed in a variety of carcinomas. These family members form either homodimers or heterodimers upon ligand binding to mediate cell growth. ErbB-3 binds and is activated by neuregulins and NTAK. It forms a heterodimer with each of the other ErbB receptors. ErbB-3 is predominantly expressed in epithelial tissues and the brain and is overexpressed in a subset of human mammary tumors. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30713 Product name: Recombinant human ERBB3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1037-1342 aa of BC082992 Sequence: TLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYMNRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT Predict reactive species Full Name: v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) Observed Molecular Weight: 200 kDa GenBank Accession Number: BC082992 Gene Symbol: ERBB3 Gene ID (NCBI): 2065 RRID: AB_3086320 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21860 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.