Iright
BRAND / VENDOR: Proteintech

Proteintech, 30457-1-AP, MUC20 Polyclonal antibody

CATALOG NUMBER: 30457-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MUC20 (30457-1-AP) by Proteintech is a Polyclonal antibody targeting MUC20 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30457-1-AP targets MUC20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue Positive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MUC20 contains serine, threonine, and proline-rich repeats in its extracellular domain and is likely to be extensively O-glycosylated. MUC20 blocks GRB2 recruitment to MET thus suppressing the GRB2-RAS pathway and inhibiting HGF-induced proliferation of MMP1 and MMP9 expression (PMID: 15314156). MUC20 is highly expressed in the kidney and localized in the proximal tubules but not in the glomerulus or distal tubules(PMID: 14565953). MUC20 was detected in most of the male urogenital tract epithelia, except for epididymis(PMID: 16997931). The expression of MUC20 is up-regulated in the kidneys of patients with immunoglobulin A nephropathy, in an animal model of lupus nephritis, and in mice with acute renal injury caused by cisplatin administration or unilateral ureteral obstruction(PMID: 14565953). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31867 Product name: Recombinant human MUC20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-555 aa of BC029267 Sequence: IEAGSAVGKTTSFAGSSASSYSPSEAALKNFTPSETLTTDIATKGPFPTSRDPLPSVPPTTTNSSRGTNSTLAKITTSAKTTMKPPTATPTTARTRPTTDMSAGENGGFLLLRLSVASPEDLTDPRVAERLMQQLHRELHAHAPHFQVSLLRVRRG Predict reactive species Full Name: mucin 20, cell surface associated Calculated Molecular Weight: 55 kDa, 71 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC029267 Gene Symbol: MUC20 Gene ID (NCBI): 200958 RRID: AB_3086323 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N307 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924