Iright
BRAND / VENDOR: Proteintech

Proteintech, 30465-1-AP, SEC23A Polyclonal antibody

CATALOG NUMBER: 30465-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SEC23A (30465-1-AP) by Proteintech is a Polyclonal antibody targeting SEC23A in WB, ELISA applications with reactivity to human samples 30465-1-AP targets SEC23A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COS-7 cells, NIH/3T3 cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33185 Product name: Recombinant human SEC23A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 660-765 aa of BC036649 Sequence: HGETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLSKVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA Predict reactive species Full Name: Sec23 homolog A (S. cerevisiae) Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC036649 Gene Symbol: SEC23A Gene ID (NCBI): 10484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15436 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924