Iright
BRAND / VENDOR: Proteintech

Proteintech, 30498-1-AP, CSN2 Polyclonal antibody

CATALOG NUMBER: 30498-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CSN2 (30498-1-AP) by Proteintech is a Polyclonal antibody targeting CSN2 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 30498-1-AP targets CSN2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HT-29 cells, NIH/3T3 cells, mouse liver tissue, mouse testis tissue, DU 145 cells, rat liver tissue Positive IHC detected in: human breast hyperplasia tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CSN2 is also named as Beta-casein and CASB.The β-casein is the most abundant protein in camel milk, and is one of the most important milk protein fractions  (PMID: 24973699). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27943 Product name: Recombinant human CSN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-226 aa of BC096194 Sequence: TIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV Predict reactive species Full Name: casein beta Observed Molecular Weight: 60 kDa GenBank Accession Number: BC096194 Gene Symbol: CSN2 Gene ID (NCBI): 1447 RRID: AB_3086338 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05814 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924