Proteintech, 30500-1-AP, TAPBP Polyclonal antibody

Size: 20ul / 150ul The TAPBP (30500-1-AP) by Proteintech is a Polyclonal antibody targeting TAPBP in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples 30500-1-AP targets TAPBP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-231 cells, THP-1 cells Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TAPBP, also known as tapasin, is a V-C1 (variable-constant) immunoglobulin superfamily (IgSF) molecule. It is involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (PMID: 11920573). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30885 Product name: Recombinant human TAPBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-120 aa of NM_003190 Sequence: GPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALD Predict reactive species Full Name: TAP binding protein (tapasin) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: NM_003190 Gene Symbol: TAPBP Gene ID (NCBI): 6892 RRID: AB_3086339 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15533 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.